PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_04932A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB
Protein Properties Length: 305aa    MW: 33518.6 Da    PI: 6.8496
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_04932AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding25.72.7e-083176144
                               TSSS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
            Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                               rg WT eE + + +a +    +   +W+++a++++ gRt  ++ s++
  Oropetium_20150105_04932A 31 RGVWTLEENKMFERALASVQWDapdRWERVAAMLP-GRTVADVASHF 76
                               899**************9988888***********.**********8 PP

2Myb_DNA-binding45.71.5e-14143187347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE++l++ + k++G g+W+ I+r + + Rt+ q+ s+ qky
  Oropetium_20150105_04932A 143 PWTEEEHKLFLMGLKKYGRGDWRNISRNFVTSRTPTQVASHAQKY 187
                                8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500906.6793080IPR017877Myb-like domain
SMARTSM007177.8E-63082IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.3E-53176IPR009057Homeodomain-like
PfamPF002491.3E-63176IPR001005SANT/Myb domain
SuperFamilySSF466894.69E-103287IPR009057Homeodomain-like
CDDcd001676.93E-63476No hitNo description
PROSITE profilePS5129417.568136192IPR017930Myb domain
SuperFamilySSF466891.29E-17138192IPR009057Homeodomain-like
TIGRFAMsTIGR015572.8E-17139190IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.602.0E-12140186IPR009057Homeodomain-like
SMARTSM007175.8E-13140190IPR001005SANT/Myb domain
CDDcd001671.89E-11143188No hitNo description
PfamPF002497.0E-12143187IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 305 aa     Download sequence    Send to blast
MMKESWMEVL PPPQAPYFAG QAGGWFLQDR RGVWTLEENK MFERALASVQ WDAPDRWERV  60
AAMLPGRTVA DVASHFDDLE NDVHFIEAGL VPFPHYGPGG GGSQAAGFTF DWDAGDDGFK  120
RSCYMVGGKR GRGPDQERKK GVPWTEEEHK LFLMGLKKYG RGDWRNISRN FVTSRTPTQV  180
ASHAQKYFIR LNSGGKDKRR SSIHDITTVN LPDEDSGNPS PSPPSVLTAT STPSSGGPAM  240
SEPFGVHIDS KPPPPPPQLG PQHHHFMSLP YGNVKLEPNS SHHAGLLDDS VLMQVHCGQL  300
QPLG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-15341011178RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00296DAPTransfer from AT2G38090Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0542811e-176BT054281.1 Zea mays full-length cDNA clone ZM_BFb0211P03 mRNA, complete cds.
GenBankBT0558021e-176BT055802.1 Zea mays full-length cDNA clone ZM_BFb0203M07 mRNA, complete cds.
GenBankBT0666721e-176BT066672.1 Zea mays full-length cDNA clone ZM_BFb0049J12 mRNA, complete cds.
GenBankHQ8587851e-176HQ858785.1 Zea mays clone UT1771 MYB transcription factor mRNA, partial cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004961904.11e-171PREDICTED: transcription factor DIVARICATA
SwissprotQ8S9H72e-80DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLK3Z8E61e-171K3Z8E6_SETIT; Uncharacterized protein
STRINGSi022816m1e-171(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP22743796
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38090.11e-82MYB family protein